PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400045076
Common NameLOC102592333
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HD-ZIP
Protein Properties Length: 289aa    MW: 32229.3 Da    PI: 6.7849
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400045076genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-18126180256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ +++keq  +Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  PGSC0003DMP400045076 126 RKKLRLSKEQAAVLEDTFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 180
                           788899***********************************************98 PP

2HD-ZIP_I/II1283.9e-41126215191
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rlskeq+++LE++F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+kev+eLr 
  PGSC0003DMP400045076 126 RKKLRLSKEQAAVLEDTFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRLQKEVSELR- 213
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 el 91 
                           +l
  PGSC0003DMP400045076 214 AL 215
                           55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575120No hitNo description
PfamPF046186.8E-153102IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.8E-18121183IPR009057Homeodomain-like
PROSITE profilePS5007117.184122182IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.0E-18122185IPR009057Homeodomain-like
SMARTSM003891.3E-15124186IPR001356Homeobox domain
PfamPF000464.9E-16126180IPR001356Homeobox domain
CDDcd000863.70E-15126183No hitNo description
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
SMARTSM003403.1E-26182225IPR003106Leucine zipper, homeobox-associated
PfamPF021835.3E-11182216IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MSGEKEDGLG LSLSLGIMSC PQNNHKIPPP FPLNLLPFMH HHQISSGRKD EGGERVRGGI  60
DMNEPARMII ECDDEEDEEE DQVLMVSSPN STVSSVSGKR SHDREENEGE RATSSLEDDG  120
GDAAARKKLR LSKEQAAVLE DTFKEHNTLN PKQKLALAKQ LNLRPRQVEV WFQNRRARTK  180
LKQTEVDCEY LKRCCENLTD ENRRLQKEVS ELRALKLSPQ LYMNMSPPTT LTMCPQCERV  240
AVSSSAASSS VTGANASRSH HHQAPVPLNK PWAAMFASKT LDVQRSQM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174182RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136130.0BT013613.1 Lycopersicon esculentum clone 132414F, mRNA sequence.
GenBankX912120.0X91212.1 L.esculentum mRNA for HD-ZIP protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347941.10.0PREDICTED: homeobox-leucine zipper protein HAT3-like
SwissprotP929532e-85ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBLM1CGA50.0M1CGA5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000668380.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.14e-66homeobox-leucine zipper protein 3
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]